PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10005192m
Common NameCICLE_v10005192mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 374aa    MW: 41646.2 Da    PI: 8.9336
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10005192mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-334599155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Ciclev10005192m 45 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 99
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-3242100IPR009057Homeodomain-like
PROSITE profilePS5129412.34742102IPR017930Myb domain
SuperFamilySSF466891.74E-1644100IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2345100IPR006447Myb domain, plants
PfamPF002491.2E-74797IPR001005SANT/Myb domain
PfamPF143793.4E-22136175IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MSSPLRERKR IMFQHHKKPS SMNSHHDRPL CVQGDSGLVL TTDPKPRLRW TVELHERFVD  60
AVTQLGGPDK ATPKTIMRVM GVKGLTLYHL KSHLQKFRLG KQPHKEFNDH SIKDGLDLQR  120
NTASSSGVIG RSMNEMQMEV QRRLHEQLEV QRHLQLRIEA QGKYMQSILE KACQTLASGE  180
TVTPASFKGT IGNQAVPDVG TMKDFCPPLN FSQFQDLNLY GGDQIDHLQQ NMDRQSSLDH  240
GFMQSNDNIC LGKKRPSPYN GGSGTGKSPL MWSDDLRLQD LATAPCIGPQ DDPFKGDQIQ  300
IAPPSNDLDS ISDIYETKPV LSGDAVSSEK KFEASSAKLE RPSPRRTPIS TERMNPAMMN  360
TGGMQQGRNS PYG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006422295.10.0hypothetical protein CICLE_v10005192mg
SwissprotQ9SAK51e-133APL_ARATH; Myb family transcription factor APL
TrEMBLV4S9K20.0V4S9K2_9R
STRINGVIT_19s0085g00890.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50442750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-130G2-like family protein